PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn191761
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HB-other
Protein Properties Length: 304aa    MW: 34273.9 Da    PI: 6.7143
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn191761genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox46.94.7e-1540781856
                HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                +F+++++p+ ++r++L+++lgL+ +q+k+WFqN+R++ k
  Achn191761 40 FFKECPHPDDTQRRQLSRELGLDPKQIKFWFQNKRTQTK 78
                6999*******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.5E-63184IPR001356Homeobox domain
PfamPF000461.5E-124078IPR001356Homeobox domain
SuperFamilySSF466891.04E-124087IPR009057Homeodomain-like
CDDcd000861.79E-124080No hitNo description
Gene3DG3DSA:1.10.10.601.1E-134087IPR009057Homeodomain-like
PROSITE profilePS5007113.5564180IPR001356Homeobox domain
PROSITE patternPS0002705578IPR017970Homeobox, conserved site
PROSITE profilePS5084813.087206303IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MPAEAGRRRD FISIKPSYVS EVALAATVVR SDDYVTTTLF FKECPHPDDT QRRQLSRELG  60
LDPKQIKFWF QNKRTQTKAQ TERADNNALR LENEKIQCEN LAFKEALKNV ICPTCGGPPV  120
GEEERQLNLQ KLRMENSQLK QDYERCSHMI ANVLGKPVEQ IQSLSRSLGL QTAGFPGQGL  180
LEISSLGHDF GNSNNCPMEH QLNGTQEMEK SAMIDIAASA MDELIRLLRV NEPVWIKSPI  240
DGRYVLHRES YNKLFPSLNH FKSSTTRMES SKDSGVVAMS AMHLLDMFLD SVHPDSNTLL  300
ISY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526595.21e-102PREDICTED: homeobox-leucine zipper protein ROC8 isoform X2
SwissprotQ9FX311e-72HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA5B3F31e-102A5B3F3_VITVI; Putative uncharacterized protein
TrEMBLD7TA281e-101D7TA28_VITVI; Putative uncharacterized protein
STRINGVIT_04s0079g00480.t011e-100(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10211732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.18e-74homeodomain GLABROUS 11